PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002157P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ZF-HD
Protein Properties Length: 180aa    MW: 19773.8 Da    PI: 7.8656
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002157P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer89.82.6e-28660257
     ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                    ++++Y+eCl+NhAaslG++a+DGCgEf+ + ++++ a+ l+CaACgCHRnFHR+ +
  MELO3C002157P1  6 SNYHYRECLRNHAASLGSYATDGCGEFTLD-DSSSPANLLHCAACGCHRNFHRKVT 60
                    5789*************************8.67778999***************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.3E-24860IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.4E-22958IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.3591059IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-171058IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.91E-1596163IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-2896165IPR009057Homeodomain-like
TIGRFAMsTIGR015655.2E-28104162IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MDGENSNYHY RECLRNHAAS LGSYATDGCG EFTLDDSSSP ANLLHCAACG CHRNFHRKVT  60
YIAGGGGRSS AATATDDDLM DYDRHAVVEY AAADTERSGG GGSKKRFRTK FTVDQKEKML  120
AFAEKLGWKL QRKDLDDEIE RFCRSVGVTR QVFKVWMHNH KNSFSSNSAS TGNASSLTQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-231051671879ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008467173.11e-133PREDICTED: zinc-finger homeodomain protein 10-like
SwissprotQ9SB613e-45ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA0A0A0LQK41e-127A0A0A0LQK4_CUCSA; Zinc finger homeodomain protein SZF-HD1
STRINGGLYMA09G30061.14e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79822844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.14e-38homeobox protein 22